PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 211aa    MW: 23770 Da    PI: 8.4992
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097227.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.19.7e-231057249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +ie k   qvtfskRr g++KKA+EL++LC++e+a+i+fs+ gk++ +
  XP_011097227.1 10 KIEVKNHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPAGKVFSF 57
                    68889999*************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-28173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.287161IPR002100Transcription factor, MADS-box
CDDcd002653.90E-35270No hitNo description
PRINTSPR004044.4E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRQKIKIEK IEVKNHLQVT FSKRRSGLFK KASELCTLCG VEIAIIVFSP AGKVFSFGHP  60
NVESIIDRFL ARSTGPNSHD PFHLVEAQRN ASVRELNLQL GQILNEVEVE RKRGDNLDNM  120
RKTNESHYWW EAPVSKLGLE ELEQLRDAME DLKKNVTQHA NKLMNPSSMF VSNLAGGVFD  180
QYESKPSHGI VSSSHVNAAV NSNFGYCHGF F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097227.11e-157PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A022RR171e-111A0A022RR17_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000948167e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-55AGAMOUS-like 62